Tags Math and Arithmetic

Animals & Plants Arts & Entertainment Auto Beauty & Health Books and Literature Business Electronics Engineering & Technology Food & Drink History Hobbies Jobs & Education Law & Government Math People & Society Science Social Studies Sports Travel & Places

0

Subjects>Math>Other Math

Give me the examples of the properties of whole numbres?

Anonymous

∙ 14y ago

Updated: 4/28/2022

the simplest answer to that is that whole numbers do not have decimals or fractions.

Wiki User

∙ 14y ago

Still curious? Ask our experts.

Chat with our AI personalities

Maxine

I respect you enough to keep it real.

Chat with Maxine

Fran

I've made my fair share of mistakes, and if I can help you avoid a few, I'd sure like to try.

Chat with Fran

Taiga

Every great hero faces trials, and you—yes, YOU—are no exception!

Chat with Taiga

Add your answer:

Earn +20 pts

Q: Give me the examples of the properties of whole numbres?

Write your answer...

Submit

Still have questions?

imp

Continue Learning about Other Math

Can you give 50 examples of non- count nouns?

Examples of non-count (mass) nouns:adviceairaluminumangerartasphaltattirebaggagebeefbloodbreadbutterchalkcheesechesscoffeeconcretecoppercouragedewdiligencedirtdusteducationelectricityenjoymentequipmentexhaustfishflourfoodfunfurnituregarbagegoldgraffitigrassgravityhappinesshardwareheliumhelphomeworkhonestyhoneyhouseworkhumidityhydrogeninformationinsurance

Give 100 examples of nouns?

A noun is a word for a person, a place, or a thing.Some examples are:airareaartbackbodybookbusinesscarcasechangechildcitycommunitycompanycountrydaydeskdoorendeyefacefactfamilyfatherfoodfriendgamegirlgovernmentgrouphandheadhealthhistoryhomehourhouseideainformationislandissuejobkidkindlawlevellifelinelotlunchmanmemberminutemomentmoneymonthmorningmothernamenightnumberofficeopinionparentpartpartypeoplepersonplacepointpowerpresidentproblemprogramquestionreasonresearchresultrightroomschoolservicesidesoupstatestorystudentsystemteacherteamthingtimewarwaterweekwomanwordworkworldyear

Give examples from daily life that air has weight?

air has weight

What is the meaning of the verb complement and give 10 examples?

what is the verb complement

What is a value that can be multiplied by itself to give the original whole number?

A square root is multiplied by itself to get a given whole number.

Trending Questions

1m is equal to how many dm? The quotient of seven and the difference of three and a number? What is the monthly interest rate if the annual is 12 percent? What is a fraction division problem that equals 8? How do you get the percent from a whole number? What is 997 rounded to the nearest 10 thousand? Information about a rectangle? What are 55 hundredths more than 9.115? What is 286 divided by 26? What does relative order mean? What is the name of a 20 congruent sided shape called? Is 42 a multiple of 8? Reciprocal of negative 4? What is 2 divided by 1 and 59? What is the difference of adding a mix number and a fraction? What is the number 33 as binary form? What is a numerical sequence? What is 203 rounded to the neartest hundred? 23 divided by 45? Half a mile is less than?

Resources

Top Categories

Product

Company

Copyright ©2025 Infospace Holdings LLC, A System1 Company. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.