2440
* Place the following in alphabetical order: 1. F2442 - 2 2. F2444 - 3 3. F2424 - 3 4. F2443 - 3
1. F2442 - 2 2. F2444 - 3 3. F2424 - 3 4. F2443 - 3
how can i solve this? 1. F2442 - 2 2. F2444 - 3 3. F2424 - 3 4. F2443 - 3 Answer----- 3,1,4,2
The correct alphabetical order is:displayduringenjoyfaceinsidenineninetyplacereplacesidesidewalksuretadpolethesewhole
events
South America
how is production to be organized
place in alphabetical order 1Gregory, Marsha 2. Greggory, Marietta 3. Gregery, Marsha 4. Gregory, Mary
Alphabetical order is a method of arranging topics or items based on the sequence of letters in the alphabet, from A to Z. This order helps readers easily locate specific topics within a table of contents or an index by following the alphabetical order of the words.
1342
To be able to place a collection of records in a convenient order for storage or reference- as in alphabetical order for example
An alphabetical list of place names (as at the back of an atlas) is called a gazetteer.